PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA30G00187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family BES1
Protein Properties Length: 306aa    MW: 33257.5 Da    PI: 8.6412
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA30G00187genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82235.24.4e-117114172145
      DUF822  72 gskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlsl 145
                 g+kp  ++e++g+ ++ s++ss+q s++ss+++sp++sy+ sp sssfpsps++++++ +  + llp+l++ ++
  AA30G00187  71 GCKPS-SSETGGTPTNFSTNSSIQPSPQSSTFPSPAPSYHGSPVSSSFPSPSHYNTNHPS--SYLLPFLHNIAS 141
                 79998.99***********************************************99887..899999998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.9E-671125IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MPVLGLKVTI SFLNTAITTK SLKLFVSKLV GSLMKTEPLI ARVRFRFHCS IGLNIQFPPI  60
SDSQSLKSIV GCKPSSSETG GTPTNFSTNS SIQPSPQSST FPSPAPSYHG SPVSSSFPSP  120
SHYNTNHPSS YLLPFLHNIA SSIPSNLPPL RISNSAPVTP PLSSPTSRGS KRKLTSQQLP  180
NATSLHNLRH PLFAISAPVS PTRRTGHQTP PTIPECDESE EDSIEDSGRW INFQSTAPPS  240
PTFNLVNQTS MSNDLKRQEC WGITGMVRGS EFEFENGTVK PWEGEMIHEV AVEDLELTLG  300
GTKTRY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284125.11e-119hypothetical protein CARUB_v10005257mg
SwissprotQ94A431e-121BEH2_ARATH; BES1/BZR1 homolog protein 2
TrEMBLR0H0R81e-119R0H0R8_9BRAS; Uncharacterized protein
STRINGBra011706.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115122333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.31e-38BES1 family protein